PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P21460_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 153aa    MW: 17887.4 Da    PI: 9.9241
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P21460_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.4e-29959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krien   rqvtfskRrng+lKKA+ELSvLCd+e+ +i+fs++gklye+ss
  GSMUA_Achr11P21460_001  9 KRIENAASRQVTFSKRRNGLLKKAFELSVLCDVEIGLIVFSPRGKLYEFSS 59
                            79***********************************************96 PP

2K-box41.26.9e-1576141570
                   K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                             +++s++ ++ ++ + e++ L k++e L+ ++ ++lGe+L+s+   eL ++e+++eksl++iR++K 
  GSMUA_Achr11P21460_001  76 DTSSTTREQDAKRKYEAESLSKKLEDLEASKQKFLGEKLDSCLSDELYEIERKIEKSLRSIRARKA 141
                             334467777888999**************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.754161IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-30323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-32384IPR002100Transcription factor, MADS-box
CDDcd002651.93E-38378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-303859IPR002100Transcription factor, MADS-box
PfamPF014863.2E-1483141IPR002487Transcription factor, K-box
PROSITE profilePS512977.85585153IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MVRGKTEMKR IENAASRQVT FSKRRNGLLK KAFELSVLCD VEIGLIVFSP RGKLYEFSSS  60
SLQSTIERYR ERTKEDTSST TREQDAKRKY EAESLSKKLE DLEASKQKFL GEKLDSCLSD  120
ELYEIERKIE KSLRSIRARK ASHDSFNFYC KFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A7e-18381280Myocyte-specific enhancer factor 2A
3kov_B7e-18381280Myocyte-specific enhancer factor 2A
3kov_I7e-18381280Myocyte-specific enhancer factor 2A
3kov_J7e-18381280Myocyte-specific enhancer factor 2A
3p57_A7e-18381280Myocyte-specific enhancer factor 2A
3p57_B7e-18381280Myocyte-specific enhancer factor 2A
3p57_C7e-18381280Myocyte-specific enhancer factor 2A
3p57_D7e-18381280Myocyte-specific enhancer factor 2A
3p57_I7e-18381280Myocyte-specific enhancer factor 2A
3p57_J7e-18381280Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2076992e-48AF207699.1 Elaeis guineensis agamous-like MADS box protein OPMADS1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384512.17e-94PREDICTED: MADS-box transcription factor 50-like
SwissprotQ9XJ601e-60MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0RU761e-106M0RU76_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P21460_0011e-105(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-59AGAMOUS-like 20